OCEAN'S FISH AND CHIPS MELKSHAM LTD
No Analysis Available
Get instant AI-powered insights about this company's financial health, risks, and trends.
Order Analysis - £10Website
https://oceansfishandchipsmelksham.co.uk/
- Description
If you've got a craving for fast food in Melksham, visit Ocean's Fish & Chips. Fish and chips, kebabs, burgers, and more. Come and visit us today!
- Phone Number
- 01225436798
- Last Checked
- 18 January 2025
Unclaimed website domain names
We think that the following unclaimed domain names would be good for your company website.
You should consider registering these names. If you don't there is a risk that your competitors will register the domains and use them for their own websites!
| Domain name | |
|---|---|
| oceansfishnchipsmelksham.org | |
| osfacm.org | |
| oceansfishnchipsmelksham.co.uk | |
| osfacm.co.uk | |
| oceansfishnchipsmelksham.org.uk | |
| osfacm.services | |
| oceansfishnchipsmelksham.com | |
| oceansfishnchipsmelksham.services | |
| oceansfishandchipsmelksham.org | |
| oceansfishandchipsmelksham.org.uk | |
| oceansfishnchipsmelksh.am | |
| osfacm.org.uk | |
| oceansfishandchipsmelksham.net | |
| osfacm.net | |
| oceansfishandchipsmelksham.com | |
| oceansfishandchipsmelksh.am | |
| oceansfishnchipsmelksham.net | |
| oceansfishandchipsmelksham.services | |
| osfacm.com |
More Company Information
Recently Viewed
Follow Company
- Receive an alert email on changes to financial status
- Early indications of liquidity problems
- Warns when company reporting is overdue
- Free service, no spam emails Follow this company